PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G270900.1.p
Common NameSb02g030470, SORBIDRAFT_02g030470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 873aa    MW: 92210.1 Da    PI: 6.3735
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G270900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-21124179156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Sobic.002G270900.1.p 124 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 179
                           688999***********************************************999 PP

2START166.22.3e-523445794205
                           HHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                 START   4 eeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                           ++a++el+k a+ +ep+W +s+      e +n de+ + f++  +     + +ea r+ g+ +  +++lv +l+d + +W+e+++    
  Sobic.002G270900.1.p 344 LAAMEELMKVAQMDEPLWLRSPdgggglETLNFDEYHRAFARVFGpspagYVSEATREAGIAIISSVDLVDSLMDAA-RWSEMFPciva 431
                           789*************************************77555********************************.*********** PP

                           EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE.............-TTS--...-TTSEE CS
                 START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd.............seqkppe..sssvvR 144
                           +a+t++ issg      g +qlm aelq+lsplvp R++vf+R+++q+ +g w++vdvSvd             + ++  +   ++++ 
  Sobic.002G270900.1.p 432 RASTTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDailrpdgggnhhhHHAH--NggAAGYMG 518
                           ************************************************************955544444443222222..256899*** PP

                           -EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                 START 145 aellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                           ++llp+g++++++ ng+skvtwv h++++++++h+l+r+l++sg+a ga++w+a lqrqc+
  Sobic.002G270900.1.p 519 CRLLPTGCIVQDMNNGYSKVTWVVHAEYDEAVVHQLYRPLLQSGQALGARRWLASLQRQCQ 579
                           ************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.97E-22106181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-23111181IPR009057Homeodomain-like
PROSITE profilePS5007118.301121181IPR001356Homeobox domain
SMARTSM003898.7E-20122185IPR001356Homeobox domain
PfamPF000464.1E-19124179IPR001356Homeobox domain
CDDcd000866.86E-20124181No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PROSITE profilePS5084841.045332583IPR002913START domain
SuperFamilySSF559617.56E-27336579No hitNo description
CDDcd088751.23E-107338579No hitNo description
SMARTSM002341.1E-40341580IPR002913START domain
PfamPF018522.9E-44344579IPR002913START domain
SuperFamilySSF559611.65E-15660862No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MSFGGMFDGA AGSGVFSYDA TGGGGTGMHN PSRLIPAPPL PKPGGFGATG LSLGLQTNME  60
GGQLADLSRM GLIGSGGSAS GGDGDSLGRA RGEDENDSRS GSDNVDGASG DELDPDNSNP  120
RKKKKRYHRH TPQQIQELEA VFKECPHPDE KQRMELSKRL NLESRQVKFW FQNRRTQMKT  180
QIERHENALL RQENDKLRAE NMTIREAMRN PICTNCGGAA VLGEVSLEEQ HLRIENARLK  240
DELDRVCALA GKFLGRPISS GSSMSLQGCS GLELGVGTNG GFGLGPLGAS ALQPLPDLMG  300
AGGLPGPVGS AAAMRLPVGI GALDGAMHGA ADGIDRTVLL ELGLAAMEEL MKVAQMDEPL  360
WLRSPDGGGG LETLNFDEYH RAFARVFGPS PAGYVSEATR EAGIAIISSV DLVDSLMDAA  420
RWSEMFPCIV ARASTTDIIS SGMGGTRSGS IQLMHAELQV LSPLVPIREV VFLRFCKQHA  480
EGLWAVVDVS VDAILRPDGG GNHHHHHAHN GGAAGYMGCR LLPTGCIVQD MNNGYSKVTW  540
VVHAEYDEAV VHQLYRPLLQ SGQALGARRW LASLQRQCQY LAILCSNSLP ARDHAAITPV  600
GRRSMLKLAQ RMTDNFCAGV CASAAQKWRR LDEWRGVGEG GGGSSAGNGG GGAAGEGEEK  660
VRMMARQSVG APGEPPGVVL SATTSVRLPV TSPQRVFDYL RDEQRRGEWD ILANGEAMQE  720
MDHIAKGQHH GNAVSLLRPN ATSGNQNNML ILQETCTDPS GSLVVYAPVD VQSMHVVMNG  780
GDSAYVSLLP SGFAILPDGH CQSSNPAQGS PNCSGGGNSS TGGSLVTVAF QILVNNLPTA  840
KLTVESVETV SNLLSCTIQK IKSALQASIV TP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120125RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509850.0AJ250985.1 Zea mays mRNA for OCL3 protein (ocl3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462701.10.0hypothetical protein SORBIDRAFT_02g030470
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLC5X6400.0C5X640_SORBI; Putative uncharacterized protein Sb02g030470
STRINGSb02g030470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1